Kv1.2 (KCNA2) Mouse Monoclonal Antibody [Clone ID: L76/36]

CAT#: 75-314

Kv1.2 (KCNA2) mouse monoclonal antibody, clone L76/36


USD 530.00

3 Weeks*

Size
    • 100 ul

Product Images

Specifications

Product Data
Clone Name L76/36
Applications IF, IHC, WB
Recommended Dilution Immunoblot, Immunocytochemistry and Immunohistochemistry
Reactivities Human, Mouse, Rat
Host Mouse
Isotype IgG2a
Clonality Monoclonal
Immunogen Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480).
Mouse: 100% identity (72/72 amino acids identical)
Rat: 100% identity (72/72 amino acids identical)
Some identity with Kv1.1, Kv1.3 and Kv1.4
Formulation State: Purified
Conjugation Unconjugated
Gene Name potassium voltage-gated channel subfamily A member 2
Synonyms Potassium voltage-gated channel subfamily A member 2, Voltage-gated potassium channel subunit Kv1.2, HBK5, NGK1, HUKIV, KCNA2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.