Kcna6 Rabbit Polyclonal Antibody
Other products for "Kcna6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB: 1:200-1:2000; IHC: 1:100-1:3000 |
Reactivities | Mouse, Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASGST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEAS RERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 , (MW: 35 kD |
Formulation | Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3. |
Purification | The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to other Kv1 by affinity chromatography on immobilized Kv1.1-GST and Kv1.4-GST, and then the antibody was affinity purified on i |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Gene Name | potassium voltage-gated channel subfamily A member 6 |
Database Link | |
Background | KV1.6 is a mammalian voltage dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.6 was first cloned from human brain. Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.he structure of KV1.6 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. The channel is expressed in neurons and other supporting cells in the brain, in cardiac and smooth muscle tissue as well as in ovary and testis and its activity influences the membrane potential and excitability of expressing cells.KV1.6 channels are sensitive to low doses of TEA (7 mM) and high doses of 4-AP (1.5 mM), the â??classicalâ? non-selective potassium channel blockers.Several toxins from snakes, scorpions and sea anemones venoms are potent blockers (affecting the channels in the nanomolar range) of KV1.6 channels. Among these the most potent and selective are a-Dendrotoxin (#D-350), (9-25 nM) and d-Dendrotoxin (#D-380), (23 nM), Agitoxin-2 (#RTA-420), (0.036 nM) Hongotoxin-1 (#RTH-400), (6 nM), Margatoxin (#RTM-325), (5 nM) and Stichodactyla Toxin (#RTS-400), (0.16 mM). |
Synonyms | FLJ25134; HBK2; KV1.6 |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.