TRAF6 Rabbit Polyclonal Antibody

CAT#: TA329145

Rabbit Polyclonal Anti-TRAF6 Antibody

Product Images

Host: Rabbit; Target Name: TRAF6; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 3.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRAF6 antibody is: synthetic peptide directed towards the C-terminal region of Human TRAF6. Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: TNF receptor associated factor 6
• Database Link:
  NP_004611
  Entrez Gene 22034 MouseEntrez Gene 7189 Human
  UniProt ID Q9Y4K3
• Background: TRAF6 is an E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, AKT1 and AKT2. It also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Leads to the activation of NF-kappa-B and JUN. It may be essential for the formation of functional osteoclasts. It seems to also play a role in dendritic cells (DCs) maturation and/or activation. It represses c-Myb-mediated transactivation, in B-lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor. It regulates osteoclast differentiation by mediating the activation of adapter protein complex 1 (AP-1) and NF-kappa-B, in response to RANK-L stimulation.
• Synonyms: MGC:3310; RNF85
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 91%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, Toll-like receptor signaling pathway, Ubiquitin mediated proteolysis