p53 DINP1 (TP53INP1) Rabbit Polyclonal Antibody

CAT#: TA329163

Rabbit Polyclonal anti-TP53INP1 antibody

Product Images

WB Suggested Anti-TP53INP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TP53INP1 antibody: synthetic peptide directed towards the C terminal of human TP53INP1. Synthetic peptide located within the following region: SFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: tumor protein p53 inducible nuclear protein 1
• Database Link:
  NP_150601
  Entrez Gene 94241 Human
  UniProt ID Q96A56
• Background: In response to double-strand DNA breaks, TP53INP1 promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. TP53INP1s and HIPK2 could be partners in regulating p53 activity. TP531NP1 plays a significant role in the progression of anaplastic carcinoma or contributes to anaplastic transformation from papillary or follicular carcinoma.
• Synonyms: p53DINP1; SIP; Teap; TP53DINP1; TP53INP1A; TP53INP1B
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 87%; Mouse: 87%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome