HMG20A Rabbit Polyclonal Antibody

CAT#: TA329301

Rabbit Polyclonal anti-HMG20A antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HMG20A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name high mobility group 20A
Background HMG20A plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also act as inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4.
Synonyms HMGX1; HMGXB1
Note Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Rabbit: 82%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.