E2F2 Rabbit Polyclonal Antibody

CAT#: TA329355

Rabbit Polyclonal Anti-E2F2 Antibody

Product Images

Host: Rabbit; Target Name: E2F2; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-E2F2 antibody is: synthetic peptide directed towards the middle region of Human E2F2. Synthetic peptide located within the following region: CSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: E2F transcription factor 2
• Database Link:
  NP_004082
  Entrez Gene 1870 Human
  UniProt ID Q14209
• Background: E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain.
• Synonyms: E2F-2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 87%; Rabbit: 79%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer