CHAC1 Rabbit Polyclonal Antibody

CAT#: TA329470

Rabbit Polyclonal anti-CHAC1 antibody

Product Images

WB Suggested Anti-CHAC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateCHAC1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHAC1 antibody: synthetic peptide directed towards the C terminal of human CHAC1. Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: ChaC glutathione specific gamma-glutamylcyclotransferase 1
• Database Link:
  NP_077016
  Entrez Gene 79094 Human
  UniProt ID Q9BUX1
• Background: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.
• Synonyms: MGC4504
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%