ZGPAT Rabbit Polyclonal Antibody

CAT#: TA329497

Rabbit Polyclonal anti-ZGPAT antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZGPAT"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the C terminal of human ZGPAT. Synthetic peptide located within the following region: AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name zinc finger CCCH-type and G-patch domain containing
Background ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.
Synonyms GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP
Note Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 79%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.