ITGB1BP3 (NMRK2) Rabbit Polyclonal Antibody

CAT#: TA329511

Rabbit Polyclonal anti-ITGB1BP3 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NMRK2"

Specifications

Product Data
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ITGB1BP3 antibody: synthetic peptide directed towards the middle region of human ITGB1BP3. Synthetic peptide located within the following region: YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name nicotinamide riboside kinase 2
Background ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).ITGB1BP3 reduces laminin matrix deposition and cell adhesion to laminin, but not to fibronectin.
Synonyms ITGB1BP3; MIBP; NRK2
Note Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%; Horse: 86%; Bovine: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.