ITGB1BP3 (NMRK2) Rabbit Polyclonal Antibody

CAT#: TA329511

Rabbit Polyclonal anti-ITGB1BP3 antibody

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ITGB1BP3 antibody: synthetic peptide directed towards the middle region of human ITGB1BP3. Synthetic peptide located within the following region: YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: nicotinamide riboside kinase 2
• Database Link:
  NP_733778
  Entrez Gene 27231 Human
  UniProt ID Q9NPI5
• Background: ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).ITGB1BP3 reduces laminin matrix deposition and cell adhesion to laminin, but not to fibronectin.
• Synonyms: ITGB1BP3; MIBP; NRK2
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%; Horse: 86%; Bovine: 79%