Zbtb38 Rabbit Polyclonal Antibody

CAT#: TA329612

Rabbit polyclonal anti-ZBTB38 antibody

Product Images

WB Suggested Anti-ZBTB38 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB38 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: zinc finger and BTB domain containing 38
• Database Link:
  NP_780746
  Entrez Gene 245007 Mouse
• Background: ZBTB38 physically associates with CtBP via a conserved CtBP binding motif, PLDLR. When heterologously targeted to DNA, it represses transcription via two independent repression domains, an N-terminal BTB domain and a PLDLR motif-containing RD2 region, in a histone deacetylase-independent and -dependent manner, respectively
• Synonyms: CIBZ; FLJ22332; FLJ31131; FLJ35036
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%