TBX10 Rabbit Polyclonal Antibody

CAT#: TA329732

Rabbit Polyclonal Anti-TBX10 Antibody

Product Images

WB Suggested Anti-TBX10 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

• 

  Rabbit Anti-TBX10 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Nuclear in hepatocytes, strong signal, wide tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBX10 antibody: synthetic peptide directed towards the N terminal of human TBX10. Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: T-box 10
• Database Link:
  NP_005986
  Entrez Gene 109575 MouseEntrez Gene 347853 Human
  UniProt ID O75333
• Background: TBX10, a member of the Tbx1-subfamily of conserved developmental genes, is located at human chromosome 11q13 and proximal mouse chromosome 19.
• Synonyms: TBX7; TBX13
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Mouse: 93%; Rat: 92%; Pig: 86%; Bovine: 86%