ASCL2 Rabbit Polyclonal Antibody

CAT#: TA329753

Rabbit Polyclonal Anti-ASCL2 Antibody

Product Images

WB Suggested Anti-ASCL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: DU145 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the middle region of human ASCL2. Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: achaete-scute family bHLH transcription factor 2
• Database Link:
  NP_005161
  Entrez Gene 430 Human
  UniProt ID Q99929
• Background: AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1649 BC028140.1 1-1649 1650-1864 BC057801.1 1286-1500
• Synonyms: ASH2; bHLHa45; HASH2; MASH2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%; Rabbit: 77%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors