FBXO3 Rabbit Polyclonal Antibody

CAT#: TA329823

Rabbit Polyclonal Anti-FBXO3 Antibody

Product Images

WB Suggested Anti-FBXO3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Small Intestine

• 

  2Hum. Fetal Lung; Host: Rabbit; Target Name: NSUN6; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  3Hum. Fetal Liver; Host: Rabbit; Target Name: FAM46C; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

• 

  4Hum. Adult Placenta; Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  5Hum. Fetal Heart; Host: Rabbit; Target Name: GNAS; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FBXO3 antibody: synthetic peptide directed towards the N terminal of human FBXO3. Synthetic peptide located within the following region: NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: F-box protein 3
• Database Link:
  NP_208385
  Entrez Gene 26273 Human
  UniProt ID Q9UK99
• Background: FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end.
• Synonyms: FBA; FBX3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome