MARCH2 Rabbit Polyclonal Antibody

CAT#: TA329861

Rabbit Polyclonal Anti-MARCH2 Antibody

Product Images

WB Suggested Anti-MARCH2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MARCH2 antibody: synthetic peptide directed towards the C terminal of human MARCH2. Synthetic peptide located within the following region: TIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: membrane associated ring-CH-type finger 2
• Database Link:
  NP_057580
  Entrez Gene 51257 Human
  UniProt ID Q9P0N8
• Background: MARCH2 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. MARCH2 may be involved in endosomal trafficking through interaction with STX6.
• Synonyms: HSPC240; MARCH-II; RNF172
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 86%; Guinea pig: 86%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane