Use1 Rabbit Polyclonal Antibody

CAT#: TA329932

Rabbit Polyclonal Anti-Use1 Antibody

Product Images

WB Suggested Anti-Use1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Use1 antibody: synthetic peptide directed towards the N terminal of mouse 2010315L10RIK. Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: unconventional SNARE in the ER 1 homolog (S. cerevisiae)
• Database Link:
  NP_080193
  Entrez Gene 67023 Mouse
  UniProt ID Q9CQ56
• Background: cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science laboratory in RIKEN.
• Synonyms: MDS032; p31; Q-SNARE; SLT1; USE1L
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 93%