Use1 Rabbit Polyclonal Antibody

CAT#: TA329933

Rabbit Polyclonal Anti-Use1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Use1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Use1 antibody: synthetic peptide directed towards the N terminal of mouse 2010315L10RIK. Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name unconventional SNARE in the ER 1 homolog (S. cerevisiae)
Background cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science laboratory in RIKEN.
Synonyms MDS032; p31; Q-SNARE; SLT1; USE1L
Note Immunogen sequence homology: Mouse: 100%; Rat: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.