Mri1 Rabbit Polyclonal Antibody

CAT#: TA329937

Rabbit Polyclonal Anti-Mri1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Mri1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Mri1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IVAKHHGVPFYVAAPSSSCDLHLESGKEIVIEERPSQELTDLNGVRIAAQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 41 kDa
Gene Name methylthioribose-1-phosphate isomerase 1
Background This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Synonyms M1Pi; MGC3207; MTNA; Ypr118w
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Horse: 92%; Yeast: 92%; Bovine: 92%; Human: 86%; Pig: 85%; Rabbit: 77%; Zebrafish: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.