Mri1 Rabbit Polyclonal Antibody
Other products for "Mri1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Mri1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IVAKHHGVPFYVAAPSSSCDLHLESGKEIVIEERPSQELTDLNGVRIAAQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 41 kDa |
Gene Name | methylthioribose-1-phosphate isomerase 1 |
Database Link | |
Background | This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome. |
Synonyms | M1Pi; MGC3207; MTNA; Ypr118w |
Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Horse: 92%; Yeast: 92%; Bovine: 92%; Human: 86%; Pig: 85%; Rabbit: 77%; Zebrafish: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.