Mri1 Rabbit Polyclonal Antibody

CAT#: TA329938

Rabbit Polyclonal Anti-Mri1 Antibody

Product Images

WB Suggested Anti-Mri1 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:1562500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mri1 antibody: synthetic peptide directed towards the N terminal of mouse 2410018C20RIK. Synthetic peptide located within the following region: LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: methylthioribose-1-phosphate isomerase 1
• Database Link:
  NP_080699
  Entrez Gene 67873 Mouse
  UniProt ID Q9CQT1
• Background: This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
• Synonyms: M1Pi; MGC3207; MTNA; Ypr118w
• Note: Immunogen sequence homology: Mouse: 100%; Pig: 93%; Bovine: 93%; Rat: 86%; Horse: 86%; Human: 86%; Dog: 79%; Rabbit: 79%