5 HT1F (HTR1F) Rabbit Polyclonal Antibody

CAT#: TA330006

Rabbit Polyclonal Anti-HTR1F Antibody

Product Images

WB Suggested Anti-HTR1F Antibody Titration: 2.5ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR1F antibody: synthetic peptide directed towards the N terminal of human HTR1F. Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: 5-hydroxytryptamine receptor 1F
• Database Link:
  NP_000857
  Entrez Gene 3355 Human
  UniProt ID P30939
• Background: The 5-HT1F receptor is present in both human vascular and neuronal tissue. This gene is localized at 3p12.
• Synonyms: 5-HT-1F; 5-HT1F; 5HT6; HTR1EL; MR77
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; Mouse: 93%; Pig: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction