Cytokeratin 14 (KRT14) Rabbit Polyclonal Antibody

CAT#: TA330018

Rabbit Polyclonal Anti-KRT14 Antibody

Product Images

WB Suggested Anti-KRT14 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:312500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KRT14 antibody: synthetic peptide directed towards the C terminal of human KRT14. Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: keratin 14
• Database Link:
  NP_000517
  Entrez Gene 16664 MouseEntrez Gene 3861 Human
  UniProt ID P02533
• Background: KRT14 is a type I keratin, which is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells.
• Synonyms: CK14; EBS3; EBS4; K14; NFJ
• Note: Immunogen sequence homology: Rat: 100%; Rabbit: 92%; Guinea pig: 85%; Mouse: 85%