BRN4 (POU3F4) Rabbit Polyclonal Antibody

CAT#: TA330129

Rabbit Polyclonal Anti-POU3F4 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "POU3F4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-POU3F4 antibody: synthetic peptide directed towards the C terminal of human POU3F4. Synthetic peptide located within the following region: ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name POU class 3 homeobox 4
Background POU3F4 (brain-specific homeobox/POU domain protein 4, brain-4, Brn-4, transcription factor 4) is a transcription factor with a POU domain.
Synonyms BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9; OTF-9; OTF9
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.