ATF6 beta (ATF6B) Rabbit Polyclonal Antibody

CAT#: TA330184

Rabbit Polyclonal Anti-CREBL1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ATF6B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CREBL1 antibody: synthetic peptide directed towards the N terminal of human CREBL1. Synthetic peptide located within the following region: EIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 77 kDa
Gene Name activating transcription factor 6 beta
Background CREBL1 bears sequence similarity with the Creb/ATF subfamily of the bZip superfamily of transcription factors. It localizes to both the cytoplasm and the nucleus. The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6.
Synonyms CREB-RP; CREBL1; G13
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.