Tle5 Rabbit Polyclonal Antibody

CAT#: TA330248

Rabbit Polyclonal Anti-Aes Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Tle5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Aes antibody is: synthetic peptide directed towards the N-terminal region of Mouse Aes. Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name amino-terminal enhancer of split
Background Aes acts as dominant repressor towards other family members. Aes inhibits NF-kappa-B-regulated gene expressionand may be required for the initiation and maintenance of the differentiated state .
Synonyms AES-1; AES-2; ESP1; GRG; GRG5; TLE5
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.