ZFP64 Rabbit Polyclonal Antibody

CAT#: TA330300

Rabbit Polyclonal Anti-ZFP64 Antibody

Product Images

Host: Rabbit; Target Name: ZFP64; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFP64 antibody is: synthetic peptide directed towards the C-terminal region of Human ZFP64. Synthetic peptide located within the following region: SFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIDPSKQPAT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: ZFP64 zinc finger protein
• Database Link:
  NP_955459
  Entrez Gene 55734 Human
  UniProt ID Q9NTW7
• Background: ZFP64 may be involved in transcriptional regulation.
• Synonyms: ZNF338
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%

Reference Data

• Protein Families: Transcription Factors