DC2L1 (DYNC2LI1) Rabbit Polyclonal Antibody

CAT#: TA330303

Rabbit Polyclonal Anti-DYNC2LI1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DYNC2LI1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DYNC2LI1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name dynein cytoplasmic 2 light intermediate chain 1
Background DYNC2LI1 may function as a motor for intraflagellar retrograde transport and functions in cilia biogenesis.
Synonyms CGI-60; D2LIC; LIC3; SRTD15
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.