CDK7 Rabbit Polyclonal Antibody

CAT#: TA330354

Rabbit Polyclonal Anti-CDK7 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CDK7"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name cyclin-dependent kinase 7
Background The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]
Synonyms CAK1; CDKN7; HCAK; MO15; p39MO15; STK1
Note Immunogen sequence homology: Bovine: 100%; Horse: 100%; Human: 100%; Pig: 100%; Dog: 94%; Guinea pig: 94%; Mouse: 88%; Rat: 88%
Reference Data
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cell cycle, Nucleotide excision repair

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.