GABRP Rabbit Polyclonal Antibody

CAT#: TA330439

Rabbit Polyclonal Anti-GABRP Antibody

Product Images

WB Suggested Anti-GABRP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: gamma-aminobutyric acid type A receptor pi subunit
• Database Link:
  NP_055026
  Entrez Gene 2568 Human
  UniProt ID O00591
• Background: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded GABRP is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone.The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded by this gene is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone.
• Synonyms: MGC126386; MGC126387
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction