HERC4 Rabbit Polyclonal Antibody

CAT#: TA330458

Rabbit Polyclonal Anti-HERC4 Antibody

Product Images

WB Suggested Anti-HERC4 Antibody Titration: 0.2-1 ug/ml; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HERC4 antibody: synthetic peptide directed towards the middle region of human HERC4. Synthetic peptide located within the following region: LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: HECT and RLD domain containing E3 ubiquitin protein ligase 4
• Database Link:
  NP_071362
  Entrez Gene 26091 Human
  UniProt ID Q5GLZ8
• Background: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a). ##Evidence-Data-START## Transcript exon combination :: AY221963.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: DKFZp564G092; KIAA1593
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Yeast: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis