SRC3 (NCOA3) Rabbit Polyclonal Antibody

CAT#: TA330568

Rabbit Polyclonal Anti-NCOA3 Antibody

Product Images

WB Suggested Anti-NCOA3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate

• 

  Host: Rabbit; Target Name: NCOA3; Sample Tissue: MCF7; Antibody Dilution: 1.0ug/ml; NCOA3 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0ug/ml using anti-NCOA3 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCOA3 antibody: synthetic peptide directed towards the middle region of human NCOA3. Synthetic peptide located within the following region: DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 155 kDa
• Gene Name: nuclear receptor coactivator 3
• Database Link:
  NP_006525
  Entrez Gene 8202 Human
  UniProt ID Q9Y6Q9
• Background: NCOA3 is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.
• Synonyms: ACTR; AIB-1; AIB1; bHLHe42; CAGH16; CTG26; KAT13B; pCIP; RAC3; SRC-3; SRC3; TNRC14; TNRC16; TRAM-1
• Note: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Dog: 90%; Mouse: 83%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors