POU2F3 Rabbit Polyclonal Antibody

CAT#: TA330591

Rabbit Polyclonal Anti-POU2F3 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "POU2F3"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution IHC, WB
Reactivities Human, Mouse, Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-POU2F3 antibody: synthetic peptide directed towards the N terminal of human POU2F3. Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name POU class 2 homeobox 3
Background POU domain genes encode a family of highly conserved transacting factors that influence the transcriptional activity of several cell type-specific and ubiquitous genes. Studies have cloned and sequenced cDNAs encoding a novel mouse POU domain protein, Oct-11, that is closely related within the POU domain to the POU class II proteins, Oct-1 and Oct-2.
Synonyms Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Note Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.