FAM222B Rabbit Polyclonal Antibody

CAT#: TA330691

Rabbit Polyclonal Anti-FAM222B Antibody

Product Images

Host: Rabbit; Target Name: FAM222B; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM222B antibody is: synthetic peptide directed towards the C-terminal region of Human FAM222B. Synthetic peptide located within the following region: VNGMAAPLAYPNGHYFQPLWNNILPTPNSDSSGSQDLAMPFHGGQPTGAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: family with sequence similarity 222 member B
• Database Link:
  NP_060652
  Entrez Gene 55731 Human
  UniProt ID Q8WU58
• Background: The function of this protein remains unknown.
• Synonyms: C17orf63
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%