TMEM116 Rabbit Polyclonal Antibody

CAT#: TA330781

Rabbit Polyclonal Anti-TMEM116 Antibody

Product Images

Host: Rabbit; Target Name: TMEM116; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMEM116 antibody is: synthetic peptide directed towards the C-terminal region of Human TMEM116. Synthetic peptide located within the following region: QRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: transmembrane protein 116
• Database Link:
  NP_612350
  Entrez Gene 89894 Human
  UniProt ID Q8NCL8
• Background: The function of this protein remains unknown.
• Synonyms: FLJ90167
• Note: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 92%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane