TMPRSS11F Rabbit Polyclonal Antibody

CAT#: TA330795

Rabbit Polyclonal Anti-TMPRSS11F Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TMPRSS11F"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TMPRSS11F antibody is: synthetic peptide directed towards the C-terminal region of Human TMPRSS11F. Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name transmembrane protease, serine 11F
Background TMPRSS11F is a probable serine protease.
Synonyms FLJ16046
Note Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Mouse: 86%; Bovine: 86%; Rat: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.