TTC30A Rabbit Polyclonal Antibody

CAT#: TA330806

Rabbit Polyclonal Anti-TTC30A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TTC30A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TTC30A antibody is: synthetic peptide directed towards the C-terminal region of Human TTC30A. Synthetic peptide located within the following region: IEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 76 kDa
Gene Name tetratricopeptide repeat domain 30A
Background TTC30A is required for polyglutamylation of axonemal tubulin. It plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.
Synonyms IFT70A
Note Human: 100%; Dog: 79%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.