Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody

CAT#: TA330905

Rabbit Polyclonal Anti-SEMA3B Antibody

Product Images

Host: Rabbit; Target Name: SEMA3B; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SEMA3B antibody is: synthetic peptide directed towards the middle region of Human SEMA3B. Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: semaphorin 3B
• Database Link:
  NP_004627
  Entrez Gene 7869 Human
  UniProt ID Q13214
• Background: SEMA3B inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
• Synonyms: LUCA-1; SemA; SEMA5; SEMAA; semaV
• Note: Human: 100%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: Axon guidance