Mitocondrial Translational Initiation Factor 3 (MTIF3) Rabbit Polyclonal Antibody

CAT#: TA330929

Rabbit polyclonal Anti-MTIF3 Antibody

Product Images

WB Suggested Anti-MTIF3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTIF3 antibody: synthetic peptide directed towards the middle region of human MTIF3. Synthetic peptide located within the following region: AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: mitochondrial translational initiation factor 3
• Database Link:
  NP_690876
  Entrez Gene 219402 Human
  UniProt ID Q9H2K0
• Background: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.
• Synonyms: IF3mt
• Note: Human: 100%