PCDHGB1 Rabbit Polyclonal Antibody

CAT#: TA331061

Rabbit polyclonal Anti-PCDHGB1 Antibody

Product Images

WB Suggested Anti-PCDHGB1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCDHGB1 antibody: synthetic peptide directed towards the N terminal of human PCDHGB1. Synthetic peptide located within the following region: SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: protocadherin gamma subfamily B, 1
• Database Link:
  NP_115266
  Entrez Gene 56104 Human
  UniProt ID Q9Y5G3
• Background: PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
• Synonyms: PCDH-GAMMA-B1
• Note: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Mouse: 92%; Pig: 90%; Guinea pig: 90%; Bovine: 85%; Horse: 83%; Zebrafish: 83%