PCDHGB5 Rabbit Polyclonal Antibody

CAT#: TA331062

Rabbit polyclonal Anti-PCDHGB5 Antibody

Product Images

Host: Rabbit; Target Name: PCDHGB5; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCDHGB5 antibody is: synthetic peptide directed towards the middle region of Human PCDHGB5. Synthetic peptide located within the following region: LIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: protocadherin gamma subfamily B, 5
• Database Link:
  NP_115270
  Entrez Gene 56101 Human
  UniProt ID Q9Y5G0
• Background: PCDHGB5 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
• Synonyms: PCDH-GAMMA-B5
• Note: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 83%; Bovine: 79%; Horse: 77%