ZNF295 (ZBTB21) Rabbit Polyclonal Antibody

CAT#: TA331129

Rabbit Polyclonal Anti-ZNF295 Antibody

Product Images

WB Suggested Anti-ZNF295 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF295 antibody: synthetic peptide directed towards the N terminal of human ZNF295. Synthetic peptide located within the following region: DQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 119 kDa
• Gene Name: zinc finger and BTB domain containing 21
• Database Link:
  NP_065778
  Entrez Gene 49854 Human
  UniProt ID Q9ULJ3
• Background: ZNF295 contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZNF295 may be involved in transcriptional regulation.
• Synonyms: ZNF295
• Note: Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors