FOXP3 Rabbit Polyclonal Antibody

CAT#: TA331137

Rabbit Polyclonal Anti-FOXP3 Antibody

Product Images

WB Suggested Anti-FOXP3 Antibody Titration: 5.0-8.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Liver

• 

  ?Sample Type: Mouse Spleen frozen with positive lymphocytes/ HPF (x400); Primary Dilution: 1:100; Secondary Antibody: Vector Lab Goat Biotin-Conjugated Anti-Rabbit IgG; Secondary Dilution: 1:100; Image Submitted By: ; Atsushi Kawabata at Kansas State Univ

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: forkhead box P3
• Database Link:
  NP_054728
  Entrez Gene 20371 MouseEntrez Gene 50943 Human
  UniProt ID Q9BZS1
• Background: Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
• Synonyms: AIID; DIETER; IPEX; JM2; PIDX; XPID
• Note: Pig: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%

Reference Data

• Protein Families: Transcription Factors