SLC30A9 Rabbit Polyclonal Antibody

CAT#: TA331152

Rabbit Polyclonal Anti-SLC30A9 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SLC30A9"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9. Synthetic peptide located within the following region: LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 63 kDa
Gene Name solute carrier family 30 member 9
Background HUEL includes the putative nuclear receptor interaction motif, nuclear localization and export signals, zinc finger, leucine zipper and acidic domains. HUEL is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.
Synonyms C4orf1; GAC63; HUEL; ZNT9
Note Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 79%
Reference Data
Protein Families Transcription Factors, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.