MRG15 (MORF4L1) Rabbit Polyclonal Antibody
Other products for "MORF4L1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MORF4L1 antibody: synthetic peptide directed towards the middle region of human MORF4L1. Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | mortality factor 4 like 1 |
Database Link | |
Background | MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation. |
Synonyms | Eaf3; FWP006; HsT17725; MEAF3; MORFRG15; MRG15; S863-6 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.