MINPP1 Rabbit Polyclonal Antibody
Other products for "MINPP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 52 kDa |
Gene Name | multiple inositol-polyphosphate phosphatase 1 |
Database Link | |
Background | This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway. |
Synonyms | HIPER1; MINPP2; MIPP |
Note | Human: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.