RIN2 Rabbit Polyclonal Antibody

CAT#: TA331221

Rabbit Polyclonal Anti-RIN2 Antibody

Product Images

Host: Rabbit; Target Name: RIN2; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human RIN2. Synthetic peptide located within the following region: RTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCARDSGYDSLSNRLSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: Ras and Rab interactor 2
• Database Link:
  NP_061866
  Entrez Gene 54453 Human
  UniProt ID Q8WYP3
• Background: The function of this protein remains unknown.
• Synonyms: MACS; RASSF4
• Note: Human: 100%; Rat: 83%; Mouse: 83%; Dog: 80%; Pig: 80%; Horse: 80%; Bovine: 80%