Tropomodulin 4 (TMOD4) Rabbit Polyclonal Antibody

CAT#: TA331238

Rabbit Polyclonal Anti-TMOD4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TMOD4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TMOD4 antibody is: synthetic peptide directed towards the N-terminal region of Human TMOD4. Synthetic peptide located within the following region: PEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQYLEQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name tropomodulin 4
Background TMOD4 blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton.
Synonyms SK-TMOD
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.