ITIH5 Rabbit Polyclonal Antibody

CAT#: TA331263

Rabbit Polyclonal Anti-ITIH5 Antibody

Product Images

WB Suggested Anti-ITIH5 Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ITIH5 antibody is: synthetic peptide directed towards the N-terminal region of Human ITIH5. Synthetic peptide located within the following region: AAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 103 kDa
• Gene Name: inter-alpha-trypsin inhibitor heavy chain family member 5
• Database Link:
  NP_085046
  Entrez Gene 80760 Human
  UniProt ID Q86UX2
• Background: This gene encodes a heavy chain component of one of the inter-alpha-trypsin inhibitor (ITI) family members. ITI proteins are involved in extracellular matrix stabilization and in the prevention of tumor metastasis. They are also structurally related plasma serine protease inhibitors and are composed of a light chain and varying numbers of heavy chains. This family member is thought to function as a tumor suppressor in breast and thyroid cancers. Alternative splicing results in multiple transcript variants.
• Synonyms: ITI-HC5; PP14776
• Note: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 79%