TMED2 Rabbit Polyclonal Antibody

CAT#: TA331366

Rabbit Polyclonal Anti-TMED2 Antibody

Product Images

WB Suggested Anti-TMED2 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMED2 antibody is: synthetic peptide directed towards the middle region of Human TMED2. Synthetic peptide located within the following region: SNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: transmembrane p24 trafficking protein 2
• Database Link:
  NP_006806
  Entrez Gene 10959 Human
  UniProt ID Q15363
• Background: TMED2 is involved in vesicular protein trafficking and mainly functions in the early secretory pathway but also in post-Golgi membranes.
• Synonyms: p24; P24A; p24b1; p24beta1; RNP24
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane