C6ORF182 (CEP57L1) Rabbit Polyclonal Antibody

CAT#: TA331424

Rabbit polyclonal Anti-C6orf182 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CEP57L1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C6orf182 antibody: synthetic peptide directed towards the middle region of human C6orf182. Synthetic peptide located within the following region: LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name centrosomal protein 57 like 1
Background The exact functions of C6orf182 remain unknown.
Synonyms bA487F23.2; C6orf182; cep57R
Note Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.