GPR115 (ADGRF4) Rabbit Polyclonal Antibody

CAT#: TA331606

Rabbit Polyclonal Anti-GPR115 Antibody

Product Images

Host: Rabbit; Target Name: GPR115; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR115 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR115. Synthetic peptide located within the following region: SQATMICCLVFFLSTECSHYRSKIHLKAGDKLQSPEGKPKTGRIQEKCEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: adhesion G protein-coupled receptor F4
• Database Link:
  NP_722580
  Entrez Gene 221393 Human
  UniProt ID Q8IZF3
• Background: GPR115 is an orphan receptor.
• Synonyms: GPR115; PGR18
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Dog: 86%; Rabbit: 86%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane