GPR162 Rabbit Polyclonal Antibody

CAT#: TA331838

Rabbit Polyclonal Anti-GPR162 Antibody

Product Images

Host: Rabbit; Target Name: GPR162; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR162 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR162. Synthetic peptide located within the following region: ILSISAKQQKHKPLELLLCFLAGTHILMAAVPLTTFAVVQLRRQASSDYD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: G protein-coupled receptor 162
• Database Link:
  NP_062832
  Entrez Gene 27239 Human
  UniProt ID Q16538
• Background: This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: A-2; GRCA
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane